| Desktop | 64/100 | ❗ |
| Mobile | 0/100 | ✘ |
| Field | Data | Result |
|---|---|---|
| Page Size | 298 KB | ✔ |
| Compression | 59 KB (-80.2%) | ✔ |
| Text/Html Ratio | 3860 / 304662 (bytes) = 1.27% | ✘ |
| Load Time | 0.79 second | ✔ |
| Mobile Ready | 0/100 | ✘ |
| In-Page Links | 15 | ✔ |
| Doc Type | HTML 5 | ✔ |
| Encoding | UTF-8 | ✔ |
| Declared Language | German | ✔ |
| Preferred Domain | Yes | ✔ |
| Robots.txt | Yes | ✔ |
| Url Rewrite | No | ✔ |
| Underscores in url | No | ✔ | Images Without ALT | 0 / 1 | ✔ |
| Embedded Objects (Desktop) | No | ✔ |
| Embedded Objects (Mobile) | No | ✔ |
| Iframe | No | ✔ |
| Custom 404 page | Yes | ✔ |
| Email Privacy | Yes | ✔ |
| Gsafe browsing | Yes | ✔ |
| Analytics | No | ✘ |
| W3C Validity | No | ✘ |
| Keywords | Freq | Title | Desc | <H> |
|---|---|---|---|---|
| lesen | 3 | ✘ | ✘ | ✘ |
| schenken | 2 | ✔ | ✘ | ✘ |
| kraft | 2 | ✘ | ✘ | ✘ |
| mehr | 2 | ✘ | ✘ | ✘ |
| sababosnien | 1 | ✘ | ✘ | ✘ |
| ricacôted’ivoirecuraçaodänemarkdeutschlanddominicadominikanischerepublikdschibutiecuadorelsalvadoreritreaestlandfalklandinselnfäröerfidschifinnlandfrankreichfranzösisch-guayanafranzösisch-polynesiengabungambiageorgienghanagibraltargrenadagriechenlandgrönlandguadeloupeguamguatemalaguernseyguineaguinea-bissauguyanahaitihondurasindienindonesienirakiranirlandislandisleofmanisraelitalienjamaikajapanjemenjerseyjordanienkaimaninselnkambodschakamerunkanadakasachstankatarkeniakirgisistankiribatikokosinselnkolumbienkomorenkongo-brazzavillekongo-kinshasakosovokroatienkubakuwaitlaoslesotholettlandlibanonliberialibyenliechtensteinlitauenluxemburgmadagaskarmalawimalaysiamaledivenmalimaltamarokkomarshallinselnmartiniquemauretanienmauritiusmayottemexikomikronesienmonacomongoleimontenegromontserratmosambikmyanmarnamibianaurunepalneukaledonienneuseelandnicaraguaniederlandenigernigerianiuenordkoreanördlichemarianennordmazedoniennorfolkinselnorwegenomanÖsterreichpakistanpalästinensischeautonomiegebietepalaupanamapapua-neuguineaparaguayperuphilippinenpolenportugalpuertoricorepublikmoldauréunionruandarumänienrusslandsalomonensambiasamoasanmarinosão | 1 | ✘ | ✘ | ✘ |
| verdechilechinacookinselncosta | 1 | ✘ | ✘ | ✘ |
| darussalambulgarienburkinafasoburundicabo | 1 | ✘ | ✘ | ✘ |
| ozeanbrunei | 1 | ✘ | ✘ | ✘ |
| indischen | 1 | ✘ | ✘ | ✘ |
| jungferninselnbritischesterritorium | 1 | ✘ | ✘ | ✘ |
| undherzegowinabotsuanabrasilienbritische | 1 | ✘ | ✘ | ✘ |
| eustatius | 1 | ✘ | ✘ | ✘ |
| undpríncipesaudi-arabienschwedenschweizsenegalserbienseychellensierraleonesimbabwesingapursintmaartenslowakeisloweniensomaliasonderverwaltungsregionhongkongsonderverwaltungsregion | 1 | ✘ | ✘ | ✘ |
| poeme-mail-adressepflichtfeldtelefonnummerinternationalafghanistanÄgyptenÅlandinselnalbanienalgerienamerikanisch-samoaamerikanischejungferninselnandorraangolaanguillaantigua | 1 | ✘ | ✘ | ✘ |
|
With 0.79 seconds in page load, 298 KB of page size and all other reports below, the seniorentraeume.com has a SEO score of 60 out of 100 |
| Title | Geschenkartikel, Edelsteine, energetischer Schmuck, Ketten, Armbänder, Ohrringe, Engel jeglicher Art, Cabochons, Strickpuppen - vieles Handmade | Glück schenken - Aurora |
| Description | Für jeden Anlass das passende Geschenk |
| Keyword |
| Age | 0 Years, 3 Days |
| Created | 4th-Oct-2022 |
| Updated | 4th-Oct-2022 |
| Expiry | 4th-Oct-2023 |
| Host | Type | Ttl | Other |
|---|---|---|---|
| seniorentraeume.com | A | 25 | ip:52.211.176.182 |
| seniorentraeume.com | A | 25 | ip:54.194.222.126 |
| seniorentraeume.com | NS | 3600 | target:ns12.jimdo.com |
| seniorentraeume.com | NS | 3600 | target:ns11.jimdo.com |
| seniorentraeume.com | SOA | 3600 | mname:ns11.jimdo.comrname:hostmaster.jimdo.comserial:2022100772refresh:10800retry:3600expire:604800minimum-ttl:600 |
| seniorentraeume.com | MX | 3600 | pri:10target:mx.seniorentraeume.com.cust.A.hostedemail.com |
| seniorentraeume.com | TXT | 3600 | txt:v=spf1 mx:seniorentraeume.com include:_spf.hostedemail.com ~all |
|
Domain Name: seniorentraeume.com Registry Domain ID: 2729893046_DOMAIN_COM-VRSN Registrar WHOIS Server: whois.psi-usa.info Registrar URL: https://www.psi-usa.info Updated Date: 2022-10-04T20:41:06Z Creation Date: 2022-10-04T20:41:02Z Registrar Registration Expiration Date: 2023-10-04T20:41:02Z Registrar: PSI-USA, Inc. dba Domain Robot Registrar IANA ID: 151 Registrar Abuse Contact Email: domain-abuse@psi-usa.info Registrar Abuse Contact Phone: +49.94159559482 Domain Status: clientTransferProhibited https://www.icann.org/epp#clientTransferProhibited Registry Registrant ID: REDACTED FOR PRIVACY Registrant Name: REDACTED FOR PRIVACY Registrant Organization: Registrant Street: REDACTED FOR PRIVACY Registrant City: REDACTED FOR PRIVACY Registrant State/Province: DE Registrant Postal Code: REDACTED FOR PRIVACY Registrant Country: DE Registrant Phone: REDACTED FOR PRIVACY Registrant Phone Ext: REDACTED FOR PRIVACY Registrant Fax: REDACTED FOR PRIVACY Registrant Fax Ext: REDACTED FOR PRIVACY Registrant Email: https://whoispro.domain-robot.org/whois/seniorentraeume.com Registry Admin ID: REDACTED FOR PRIVACY Admin Name: REDACTED FOR PRIVACY Admin Organization: REDACTED FOR PRIVACY Admin Street: REDACTED FOR PRIVACY Admin City: REDACTED FOR PRIVACY Admin State/Province: REDACTED FOR PRIVACY Admin Postal Code: REDACTED FOR PRIVACY Admin Country: REDACTED FOR PRIVACY Admin Phone: REDACTED FOR PRIVACY Admin Phone Ext: REDACTED FOR PRIVACY Admin Fax: REDACTED FOR PRIVACY Admin Fax Ext: REDACTED FOR PRIVACY Admin Email: https://whoispro.domain-robot.org/whois/seniorentraeume.com Registry Tech ID: REDACTED FOR PRIVACY Tech Name: REDACTED FOR PRIVACY Tech Organization: REDACTED FOR PRIVACY Tech Street: REDACTED FOR PRIVACY Tech City: REDACTED FOR PRIVACY Tech State/Province: REDACTED FOR PRIVACY Tech Postal Code: REDACTED FOR PRIVACY Tech Country: REDACTED FOR PRIVACY Tech Phone: REDACTED FOR PRIVACY Tech Phone Ext: REDACTED FOR PRIVACY Tech Fax: REDACTED FOR PRIVACY Tech Fax Ext: REDACTED FOR PRIVACY Tech Email: https://whoispro.domain-robot.org/whois/seniorentraeume.com Name Server: ns11.jimdo.com Name Server: ns12.jimdo.com DNSSEC: unsigned URL of the ICANN WHOIS Data Problem Reporting System: https://wdprs.internic.net/ >>> Last update of WHOIS database: 2022-10-07T17:58:13Z |
| Server IP | 34.246.58.214 |
| Server Location | Ireland |
| Service Provider | AMAZON-02 |
| Domains (TLD) | Status |
|---|---|
| seniorentraeume.net | Available |
| seniorentraeume.org | Already Registered |
| seniorentraeume.biz | Already Registered |
| seniorentraeume.io | Already Registered |
| seniorentraeume.info | Already Registered |
| Domains (TLD) | Status |
|---|---|
| qeniorentraeume.com | Available |
| weniorentraeume.com | Available |
| eeniorentraeume.com | Available |
| zeniorentraeume.com | Available |
| xeniorentraeume.com | Available |
| Ysrviptransfer.com |
| Akydaradzi.com |
| Justrighthandyman.org |
| Madisonrenewables.com |
| Aranz.org |
| Yeditepeteknik.org |
| Duoruidianzi.com |
| Knowledgetransforms.com |
| Drnoelamaro.com |
| Aalaskasoapbasket.com |